Phospholipase C like 1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Novus Biologicals NBP1-80896-25ul

Product Code. 18456640

Description

Phospholipase C like 1 Polyclonal specifically detects Phospholipase C like 1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Phospholipase C like 1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: but catalytically inactive protein, inactive phospholipase C-like protein 1, MGC126580, MGC138190, phospholipase C, epsilon, phospholipase C-deleted in lung carcinoma, phospholipase C-like 1, phospholipase C-related but catalytically inactive protein, PLCE, PLCL, PLC-L1, PRIP
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PLCL1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LRYLVSRSKQPLDFMEGNQNTPRFMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTEEEF
• Quantity: 25ul
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 5334
• Target Species: Human
• Isotype: IgG

For Research Use Only