missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF654 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
£358.00
Specifications
Antigen | ZNF654 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZNF654 Polyclonal specifically detects ZNF654 in Human samples. It is validated for Western Blot.Specifications
ZNF654 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
FLJ10997, FLJ21142, zinc finger protein 654 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF654 (NP_060763). Peptide sequence GRKFRNRGLMQKHLKNHVKKIQRQQIAAAQQDDQEVTALEEINCSSSSIS | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
55279 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title