PLA2G12B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand:  Bio-Techne NBP2-31685

Product Code. 18106902

Description

PLA2G12B Polyclonal specifically detects PLA2G12B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PLA2G12B
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: Q9BX93
• Gene Symbols: PLA2G12B
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DTEESYSDWGLRHLRGSFESVNSYFDSFLELLGGKNGVCQYRCRYGKAPMPRPGYKPQEPNGCGSYFLGLKVPESM
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 84647
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: group XIIB secretory phospholipase A2-like protein, group XIII secreted phospholipase A2, Group XIII secretory phospholipase A2-like protein, GXIIBMGC138151, GXIII sPLA2-like, GXIIIsPLA2, phospholipase A2, group XIIB, phospholipase A2, group XIII, PLA2G13, sPLA2-GXIIB
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only