Antibodies are glycoproteins that serve an essential role in the immune system to protects animals from infection, or the cytotoxic effects of foreign compounds, by binding with high affinity to invasive molecules; classified as primary or secondary.
Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.