Primary antibodies are immunoglobulins that recognize and bind to a specific antigen of interest with high affinity and specificity to purify, detect, and measure that antigen. Includes antibody pairs for specific biochemical applications.
Synthetic peptides corresponding to GMPS(guanine monphosphate synthetase) The peptide sequence was selected from the middle region of GMPS. Peptide sequence VCTALLNRALNQEQVIAVHIDNGFMRKRESQSVEEALKKLGIQVKVINAA.